Advertisement is the 24111444:th largest website within the world. The website is created in 26/10/2012, owned by unavailable person, currently located in United States and is running on IP registered by FastDomain, Inc. network. This site not uses Javascript for user interaction. This site uses CSS to manage the site layout. This site is running on the nginx/1.12.1 webserver. The server side programming lanquage of the site is not detected. Google Pagerank is 0 and it's domain is Commercial. estimated worth is $166.35, with 42 estimated visites per day and ad revenue of $ 0.13.

Title: Printing, Color Copies, Website Design and Direct Mail Services

Description: At QPG Media our multi-service business model makes it easy for a business owner to deal with one company to handle their Printing, Web Design & Development, Data, and Direct Mail Service needs. We work with small and middle sized businesses to maximize their printing, color copies, brochures, website…

Keywords: Website Design Web Development Printing Direct Mail Color COPIES Copy New York NYC Bulk Services Press Photo Poster Business Card Online Postcard Brochure Companies Professional Digital BEST Banner Company Custom

Created: 26/10/2012

Expires: unavailable

Owner: unavailable

Hosted in: United States

Host IP:

ICANN Registrar: FastDomain, Inc.

Domain Suffix: com

Domain Archive: in the past

Alexa Rank: #24111444

Links In: 3

Google Page Rank: 0

HOSTCLASSTYPETTLDATA IN A 14400 ip: IN NS 86400 target: IN NS 86400 target: IN SOA 86400 mname:
serial: 2016020400
refresh: 86400
retry: 7200
expire: 3600000
minimum-ttl: 300 IN MX 14400 pri: 0
target: IN TXT 14400 txt: v=spf1 a mx ptr ?all
entries: v=spf1 a mx ptr ?all

Server Name:

Server Type: nginx/1.12.1

Server Side Language: unavailable

Javascript Usage: no

CSS Usage: yes

RSS Usage: no

Google AdSense Usage: no

Additional technologies usage: jQuery | Google Analytics | GoogleFontApi - Daily Traffic Rank Trend In The Past 4 Months

Keyword Count Density
Printing 70 6.53
Design 28 2.61
Mail 25 2.33
Services 25 2.33
Color 17 1.59
Direct 16 1.49
Business 16 1.49
Copies 13 1.21
Mailing 6 0.56
Bulk 6 0.56
Provide 5 0.47
We're 5 0.47
Qpg 5 0.47
Development 5 0.47
Marketing 4 0.37
Shirt 4 0.37
Engine 4 0.37
Envelope 4 0.37
Transfer 4 0.37
Graphic 4 0.37
Broadcasting 4 0.37

We are absolutely certain that every one is able to earn money from his website, Therefor we will display a short estimated numbers that might be achievable through dedication and seriousness work on your website.

Our estimations point that your Website Value is $166.35, Your Daily Visitors could be in the area of 42 per day and your potential Daily Revenues could be around $0.13.

Server Country Code: US

Server Country Name: United States

Server City Name: Provo

Server Region Name: UT

Server Zip Code: 84606

Server Latitude: 40.218101501465

Server Longitude: -111.61329650879

From - to Netname Country Admin Tech Status - IANA-BLK EU # Country field is actually a DUMY-RIPE DUMY-RIPE ALLOCATED UNSPEC
Address 01000110.00101000.11001011.01011000
Netmask = 24 11111111.11111111.11111111.00000000
Wildcard 00000000.00000000.00000000.11111111
Network 01000110.00101000.11001011.00000000
HostMin 01000110.00101000.11001011.00000001
HostMax 01000110.00101000.11001011.11111110
Broadcast 01000110.00101000.11001011.11111111
Hosts/Net 254 Class A

vpgprintinganddirectmailservices, qegprintinganddirectmailservices, qvgprintinganddirectmailservices, qpgprintinganddirectmailservices, qpgpiintinganddirectmailservices, qpgprintnganddirectmailservices, qpgprintinanddirectmailservices, qpgprintingauddirectmailservices, qpgprintinganmdirectmailservices, qpgprintinganrdirectmailservices, qpgprintinganddsrectmailservices, qpgprintinganddifectmailservices, qpgprintinganddirbctmailservices, qpgprintinganddirpctmailservices, qpgprintinganddireckmailservices, qpgprintinganddirecsmailservices, qpgprintinganddirecumailservices, qpgprintinganddirectrailservices, qpgprintinganddirecttailservices, qpgprintinganddirectwailservices, qpgprintinganddirectmnilservices, qpgprintinganddirectmailstrvices, qpgprintinganddirectmailseruices, qpgprintinganddirectmailservrces, qpgprintinganddirectmailserviees, qpgprintinganddirectmailservifes, qpgprintinganddirectmailservices, qpgprintinganddierctmailservices, qpdgprintinganddirectmailservices, qpgpirintinganddirectmailservices, qpgpurintinganddirectmailservices, qpgprintivnganddirectmailservices, qpgprintinxganddirectmailservices, qpgprintingaynddirectmailservices, qpgprintingandditrectmailservices, qpgprintinganddiyrectmailservices, qpgprintinganddirexctmailservices, qpgprintinganddirectfmailservices, qpgprintinganddirectmcailservices, qpgprintinganddirectmnailservices, qpgprintinganddirectmoailservices, qpgprintinganddirectmaialservices, qpgprintinganddirectmailwservices, qpgprintinganddirectmailsservices, qpgprintinganddirectmailseirvices, qpgprintinganddirectmailsekrvices, qpgprintinganddirectmailserhvices, qpgprintinganddirectmailsernvices, qpgprintinganddirectmailservicmes, qpgprintinganddirectmailservicest,

/פעפרןמאןמעשמגגןרקבאצשןךדקרהןבקד, йзпзкштештпфтввшкусеьфшдыукмшсуы, ضحلحقهافهالشاييهقثؤفىشهمسثقرهؤثس, ,зжзисхшсхжьхаасиеъшпьсвяеиэсъея, apfpribtibf*bssirextn*ikqercixeq, qpgprintinganddirectmailservices, ;πγπρι,τι,γα,δδιρεβτ.αιλσερνιβεσ, /פעפרןמאןמעשמגגןרקבאצשןךדקרהןבקדץבםצ, йзпзкштештпфтввшкусеьфшдыукмшсуыюсщь, ضحلحقهافهالشاييهقثؤفىشهمسثقرهؤثسوؤخى, ,зжзисхшсхжьхаасиеъшпьсвяеиэсъеялъдп, apfpribtibf*bssirextn*ikqercixeq;xon,, ;πγπρι,τι,γα,δδιρεβτ.αιλσερνιβεσβο.

Registry Domain ID: 1754942234_DOMAIN_COM-VRSN
Registrar WHOIS Server:
Registrar URL:
Updated Date: 2017-06-29T04:25:20Z
Creation Date: 2012-10-26T12:07:48Z
Registry Expiry Date: 2018-10-26T12:07:48Z
Registrar: FastDomain, Inc.
Registrar IANA ID: 1154
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientTransferProhibited
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form:
>>> Last update of whois database: 2017-08-12T09:23:33Z <<<

For more information on Whois status codes, please visit

NOTICE: The expiration date displayed in this record is the date the
registrar's sponsorship of the domain name registration in the registry is
currently set to expire. This date does not necessarily reflect the expiration
date of the domain name registrant's agreement with the sponsoring
registrar. Users may consult the sponsoring registrar's Whois database to
view the registrar's reported date of expiration for this registration.

TERMS OF USE: You are not authorized to access or query our Whois
database through the use of electronic processes that are high-volume and
automated except as reasonably necessary to register domain names or
modify existing registrations; the Data in VeriSign Global Registry
Services' ("VeriSign") Whois database is provided by VeriSign for
information purposes only, and to assist persons in obtaining information
about or related to a domain name registration record. VeriSign does not
guarantee its accuracy. By submitting a Whois query, you agree to abide
by the following terms of use: You agree that you may use this Data only
for lawful purposes and that under no circumstances will you use this Data
to: (1) allow, enable, or otherwise support the transmission of mass
unsolicited, commercial advertising or solicitations via e-mail, telephone,
or facsimile; or (2) enable high volume, automated, electronic processes
that apply to VeriSign (or its computer systems). The compilation,
repackaging, dissemination or other use of this Data is expressly
prohibited without the prior written consent of VeriSign. You agree not to
use electronic processes that are automated and high-volume to access or
query the Whois database except as reasonably necessary to register
domain names or modify existing registrations. VeriSign reserves the right
to restrict your access to the Whois database in its sole discretion to ensure
operational stability. VeriSign may restrict or terminate your access to the
Whois database for failure to abide by these terms of use. VeriSign
reserves the right to modify these terms at any time.

The Registry database contains ONLY .COM, .NET, .EDU domains and